SAB2109202-100UL Display Image

ANTI-SPACA3 (C-TERMINAL) ANTIBODY PRODUC

Code: SAB2109202-100UL D2-231

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to b...


read more

Your Price
£364.00 100UL

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Spaca3 is a sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization. It could be a potential receptor for the egg oligosaccharide residue N-acetylglucosamine, which is present in the extracellular matrix over the egg plasma membrane. The processed form has no detectable bacteriolytic activity in vitroã€

Immunogen

Synthetic peptide directed towards the C-terminal region of Mouse Spaca3

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Sequence

Synthetic peptide located within the following region: RIYCTDLLNNDLKDSIVCAMKIVQEPLGLGYWEAWRHHCQGRDLSDWVD

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SPACA3(124912)
mol wt24 kDa
shipped inwet ice
species reactivity (predicted by homology)human, goat, rabbit, pig, bovine, sheep, canine, horse, mouse
storage temp.−20°C
technique(s)western blot: 1 µg/mL
This product has met the following criteria:



Quantity
Est. Dispatch/Availability