SAB2109191-100UL Display Image

ANTI-CISD1 (C-TERMINAL) ANTIBODY PRODUCE

Code: SAB2109191-100UL D2-231

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to b...


read more

Your Price
£364.00 100UL

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

This gene encodes a protein with a CDGSH iron-sulfur domain and has been shown to bind a redox-active [2Fe-2S] cluster. The encoded protein has been localized to the outer membrane of mitochondria and is thought to play a role in regulation of oxidation. Genes encoding similar proteins are located on chromosomes 4 and 17, and a pseudogene of this gene is located on chromosome 2.

Immunogen

Synthetic peptide directed towards the C-terminal region of Human CISD1

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Sequence

Synthetic peptide located within the following region: PKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLII

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... CISD1(57396)
mol wt12 kDa
NCBI accession no.NM_018464
shipped inwet ice
species reactivity (predicted by homology)human, rabbit, guinea pig, goat, zebrafish, mouse, horse, bovine, canine
storage temp.−20°C
technique(s)western blot: 1 µg/mL
This product has met the following criteria:



Quantity
Est. Dispatch/Availability