SAB2109188-100UL Display Image

ANTI-USP17L5 (C-TERMINAL) ANTIBODY PRODU

Code: SAB2109188-100UL D2-231

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to b...


read more

Your Price
£364.00 100UL

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

USP17L5 functions in cell apoptosis and cleaves ubiquitin fusion protein substrates.

Immunogen

Synthetic peptide directed towards the C-terminal region of Human USP17L5

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Sequence

Synthetic peptide located within the following region: EQQSSLLNLSSSTPTHQESMNTGTLASLRGRARRSKGKNKHSKRALLVCQ

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... USP17L5(57396)
mol wt60 kDa
NCBI accession no.NM_001242329
shipped inwet ice
species reactivity (predicted by homology)human
storage temp.−20°C
technique(s)western blot: 1 µg/mL
This product has met the following criteria:



Quantity
Est. Dispatch/Availability