SAB2105899-100UL Display Image

Anti-PLEKHA7

Code: SAB2105899-100UL D2-231

Biochem/physiol Actions

PLEKHA7 is required for zonula adherens biogenesis and maintenance.PLEKHA7 acts via its interaction with KIAA1543/Nezha, which anchors microtubules at...


read more

Your Price
£478.00 100UL
£573.60 inc. VAT

Biochem/physiol Actions

PLEKHA7 is required for zonula adherens biogenesis and maintenance.PLEKHA7 acts via its interaction with KIAA1543/Nezha, which anchors microtubules at their minus-ends to zonula adherens, leading to recruit KIFC3 kinesin to junctional site.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human PLEKHA7

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: PESRYQTLPGRGLSGSTSRLQQSSTIAPYVTLRRGLNAESSKATFPRPKS

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... PLEKHA7(144100)
mol wt127 kDa
NCBI accession no.NM_175058
Quality Level100
shipped inwet ice
species reactivityhuman, horse, rabbit, mouse, dog, guinea pig
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q6IQ23
This product has met the following criteria: