Biochem/physiol Actions

Foxa2 is a transcription factor that is involved in embryonic development, establishment of tissue-specific gene expression and regulation of gene expression in differentiated tissues. Foxa2 is thought to act as a ′pioneer′ factor opening the compacted chromatin for other proteins through interactions with nucleosomal core histones and thereby replacing linker histones at target enhancer and/or promoter sites. In embryonic development Foxa2 is required for notochord formation. Foxa2 is involved in the development of multiple endoderm-derived organ systems such as the liver, pancreas and lungs; Foxa1 and Foxa2 seem to have at least in part redundant roles. Foxa2 modulates the transcriptional activity of nuclear hormone receptors; inhibits AR-mediated transcription from the LCN5 promoter. Foxa2 binds to fibrinogen beta promoter and is involved in IL6-induced fibrinogen beta transcriptional activation. Foxa2 interacts with the cis-acting regulatory regions of these genes. Foxa2 is involved in glucose homeostasis; regulates the expression of genes important for glucose sensing in pancreatic beta-cells and glucose homeostasis. Foxa2 is involved in regulation of fat metabolism; activates transcriptional programs of lipid metabolism and ketogenesis at low insulin state.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal of human Foxa2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: VDVEGTDYLNGDLGWSSSVSDSDERGSMQSLGSDEGYSSATVKRAKLQDG