Biochem/physiol Actions
Achaete scute-like 2 (Ascl2) is a downstream target of WNT signalling. It may act as a regulatory factor, which regulates the fate of colon cancer cells. Ascl2 is also accountable for the differentiation of the trophoblast lineage in normal placenta.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Achaete scute-like 2 (Ascl2) is a basic helix-loop-helix transcription factor. The base of small and large intestinal crypts and the placenta shows its expression. This gene is mapped to human chromosome 11p15.
Immunogen
Synthetic peptide directed towards the middle region of human ASCL2
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGL
This product has met the following criteria: