SAB2103396-100UL Display Image

Anti-SP3

Code: SAB2103396-100UL D2-231

Biochem/physiol Actions

SP3 is a transcriptional factor that can act as an activator or repressor, probably in a isoform-specific manner. SP3 binds to GT and GC boxes promote...


read more

Your Price
£478.00 100UL
£573.60 inc. VAT

Biochem/physiol Actions

SP3 is a transcriptional factor that can act as an activator or repressor, probably in a isoform-specific manner. SP3 binds to GT and GC boxes promoters elements.This gene belongs to a family of Sp1 related genes that encode transcription factors that regulate transcription by binding to consensus GC- and GT-box regulatory elements in target genes. This protein contains a zinc finger DNA-binding domain and several transactivation domains, and has been reported to function as a bifunctional transcription factor that either stimulates or represses the transcription of numerous genes. Transcript variants encoding different isoforms have been described for this gene, and one has been reported to initiate translation from a non-AUG (AUA) start codon. Additional isoforms, resulting from the use of alternate downstream translation initiation sites, have also been noted.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human SP3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: TAGINADGHLINTGQAMDSSDNSERTGERVSPDINETNTDTDLFVPTSSS

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SP3(6670)
mol wt82 kDa
NCBI accession no.NM_003111
Quality Level100
shipped inwet ice
species reactivitybovine, dog, human, guinea pig, rabbit, mouse, horse, rat
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q02447
This product has met the following criteria: