Application
Anti-C9ORF117 antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
C9ORF117 (chromosome 9 open reading frame 117) gene encodes a protein located on to 9q34.11. It is a target gene for hsa-miR-151a-3p and was used to examine the association of human diseases with the predicted target genes. Expression of C9ORF117 gene was used to study the mechanisms of respiratory sensitization.
Immunogen
Synthetic peptide directed towards the N terminal region of human C9orf117
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LAKEMEKDAFEAQLAQVRHEFQETKDQLTTENIILGGKLAALEEFRLQKE
This product has met the following criteria: