Anti-KIAA0319

Application

Anti-KIAA0319 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25µg/mL. It is also useful for immunohistochemistry at a concentration of 4-8µg/mL.

Biochem/physiol Actions

KIAA0319 gene encodes a single-pass type I membrane protein primarily expressed in brain cortex, putamen, amygdala, hippocampus and cerebellum. It plays a crucial role in regulating neuronal migration and cell adhesion and hence facilitates the development of cerebral cortex. KIAA0319 may also regulate the growth and differentiation of dendrites.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human KIAA0319

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: EEMSEYSDDYRELEKDLLQPSGKQEPRGSAEYTDWGLLPGSEGAFNSSVG