AV46385-100UL Display Image

Anti-ST3GAL5

Code: AV46385-100UL D2-231

Application

Anti-ST3GAL5 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25µg/ml. It is also useful for immunohistochemistry at a co...


read more

Your Price
£377.00 100UL
£452.40 inc. VAT

Application

Anti-ST3GAL5 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25µg/ml. It is also useful for immunohistochemistry at a concentration of 4-8µg/ml.

Biochem/physiol Actions

ST3GAL5 (ST3 beta-galactoside alpha-2,3-sialyltransferase 5) gene also known as SIAT9, SIATGM3S, ST3GalV or GM3 synthase encodes for a Golgi type II membrane protein belongs to the glycosyltransferase family 29. ST3GAL5 plays a crucial role in the formation of GM3 using lactosylceramide as the substrate. Loss of function mutation in the ST3GAL5, encoding GM3 synthase results in incapability to synthesize alpha and beta series of gangliosides that may cause infantile epilepsy syndrome.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human ST3GAL5

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: DSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ST3GAL5(8869)
mol wt48 kDa
NCBI accession no.NP_003887
Quality Level100
shipped inwet ice
species reactivitymouse, human, horse, rabbit, rat, pig
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q6NZX4
This product has met the following criteria: