AV40125-100UL Display Image

Anti-SIRT5

Code: AV40125-100UL D2-231

Application

Anti-SIRT5 (AB2) antibody produced in rabbit is suitable for western blot applications.

Biochem/physiol Actions

SIRT5 (Sirtuin 5) is ...


read more

Your Price
£377.00 100UL
£452.40 inc. VAT

Application

Anti-SIRT5 (AB2) antibody produced in rabbit is suitable for western blot applications.

Biochem/physiol Actions

SIRT5 (Sirtuin 5) is associated with metabolism and aging process. It has been reported in a study that SIRT5 influences urea cycle pathway by NAD-dependent deacetylation and subsequent activation of carbamoyl phosphate synthetase 1 (CPS1), which plays a vital role in the initial step of urea cycle for the detoxification and removal of ammonia. In non-small cell-lung cancer cells, SIRT5 contributions have also been observed for the cancer cell growth and drug resistance. Study shows that SIRT5 may possess oncogenic property.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

SIRT5 (Sirtuin 5) is a mitochondrial matrix protein belonging to the class III of the sirtuin family. It is localized inside the mitochondria and within the cytosol and nucleus. The protein is widely expressed in the brain, heart, liver and kidney. It is composed of very short amino and carboxyl terminal sequences flanking region with the conserved, catalytic sirtuin center domain.

Immunogen

Synthetic peptide directed towards the C terminal region of human SIRT5

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: HCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFSHLIS

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SIRT5(23408)
mol wt33 kDa
NCBI accession no.NP_036373
Quality Level100
shipped inwet ice
species reactivitygoat, human
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q5T295
This product has met the following criteria: