Biochem/physiol Actions

The gene ZSCAN21 (zinc finger and SCAN domain containing 21) encodes a transcription factor that transcriptionally regulates the gene SNCA that encodes α-synuclein in primary neuronal cultures. α-Synuclein is a presynaptic neuronal protein that is associated with Parkinson disease (PD). Therefore, the ZSCAN21 gene may serve as a potential target in the treatment of PD.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

The gene ZSCAN21 (zinc finger and SCAN domain containing 21), also referred to as NY-REN-21, encodes a C2H2 type multi-finger protein that contains an N-terminal SCAN (SRE-ZBP, CTfin51, AW-1 (ZNF174), and Number 18 cDNA or ZnF20) domain and a predicted coil at the central region. The SCAN domain has the ability to form homodimers.

Immunogen

Synthetic peptide directed towards the C terminal region of human ZSCAN21

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: AFNHSSNFNKHHRIHTGEKPYWCHHCGKTFCSKSNLSKHQRVHTGEGEAP