AV39509-100UL Display Image

Anti-FOXA2

Code: AV39509-100UL D2-231

Application

Anti-FOXA2 (AB2) polyclonal antibody is used to tag forkhead box A2 protein for detection and quantitation by Western blotting and in cells and tissues by immunoh...


read more

Your Price
£377.00 100UL
£452.40 inc. VAT

Application

Anti-FOXA2 (AB2) polyclonal antibody is used to tag forkhead box A2 protein for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the possible roles of forkhead box A2 protein in regulation of gene sets involved with processes such as reproduction and insulin secretion.

Biochem/physiol Actions

FOXA2 is a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young.This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Two transcript variants encoding the same protein have been identified for this gene.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Forkhead proteins are transcription factors that contain a DNA binding motif, winged helix, called a forkhead box. These proteins regulate genes involved in major cell processes such as embryonic development, cell proliferation and differentiation. Forkhead box A2 (FOXA2, hepatic nuclear factor 3β, HNF3), a member of the forkhead regulatory factors, interacts with the androgen receptors to regulate prostate and epididymal genes and is as an essential activator of genes that function in multiple pathways governing insulin secretion.

Immunogen

Synthetic peptide directed towards the C terminal region of human FOXA2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: QVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNS

Specificity

Anti-FOXA2 (AB2) polyclonal antibody reacts with human, mouse, rat, and canine forkhead box A2 (hepatic nuclear factor 3β, HNF3) proteins.

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... FOXA2(3170)
mol wt48 kDa
NCBI accession no.NP_068556
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9Y261
This product has met the following criteria: