AV39137-100UL Display Image

Anti-TSC22D2

Code: AV39137-100UL D2-231

Biochem/physiol Actions

Transforming growth factor (TGF)-β-stimulated clone 22 domain family of leucine zippers is involved in cellular osmotic stress response. TSC22D isofor...


read more

Your Price
£478.00 100UL
£573.60 inc. VAT

Biochem/physiol Actions

Transforming growth factor (TGF)-β-stimulated clone 22 domain family of leucine zippers is involved in cellular osmotic stress response. TSC22D isoforms are regulated by glucocorticoids and TGF-β and aid the renal cells to adapt to hypertonicity.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human TSC22D2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: CFQITSVTTAQVATSITEDTESLDDPDESRTEDVSSEIFDVSRATDYGPE

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... TSC22D2(9819)
mol wt79 kDa
NCBI accession no.NP_055594
Quality Level100
shipped inwet ice
species reactivitydog, guinea pig, mouse, rabbit, rat, human, bovine
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.O75157
This product has met the following criteria: