AV39069-100UL Display Image

Anti-NR2E3

Code: AV39069-100UL D2-231

Biochem/physiol Actions

NR2E3 is a member of nuclear receptor transcription factor family involved in embryonic development. It is a ligand-dependent retinal nuclear receptor...


read more

Your Price
£362.00 100UL
Discontinued
£434.40 inc. VAT

Biochem/physiol Actions

NR2E3 is a member of nuclear receptor transcription factor family involved in embryonic development. It is a ligand-dependent retinal nuclear receptor and regulates the number of S-cones in the retina. Mutations in gene encoding NR2E3 cause S-cone syndrome and disrupt human cone photoreceptor mosaic.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human NR2E3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: METRPTALMSSTVAAAAPAAGAASRKESPGRWGLGEDPTGVSPSLQCRVC

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... NR2E3(10002)
mol wt45 kDa
NCBI accession no.NP_055064
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9Y5X4
This product has met the following criteria: