AV36246-100UL Display Image

Anti-JAZF1

Code: AV36246-100UL D2-231

Biochem/physiol Actions

JAZF1 is a nuclear protein with three C2H2-type zinc fingers, and functions as a transcriptional repressor. Chromosomal aberrations involving this gen...


read more

Your Price
£478.00 100UL
£573.60 inc. VAT

Biochem/physiol Actions

JAZF1 is a nuclear protein with three C2H2-type zinc fingers, and functions as a transcriptional repressor. Chromosomal aberrations involving this gene are associated with endometrial stromal tumors. This gene encodes a nuclear protein with three C2H2-type zinc fingers, and functions as a transcriptional repressor. Chromosomal aberrations involving this gene are associated with endometrial stromal tumors. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Juxtaposed with another zinc finger protein 1 (JAZF1) is expressed in the nucleus where it functions as a transcriptional repressor. Alternatively spliced variants of JAZF1 have been identified and associate with various cancers including endometrial stromal tumors.

Immunogen

Synthetic peptide directed towards the N terminal region of human JAZF1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: IDTDPRVLEKQELQQPTYVALSYINRFMTDAARREQESLKKKIQPKLSLT

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... JAZF1(221895)
mol wt27 kDa
NCBI accession no.NP_778231
Quality Level100
shipped inwet ice
species reactivityrabbit, human, mouse, guinea pig, horse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q86VZ6
This product has met the following criteria: