Biochem/physiol Actions

ETV7 belongs to the ETS family of transcription factors that are important in development, differentiation and oncogenesis. It is predominantly expressed in hematopoietic tissues and promotes lymphomagenesis along with Myc. ETV7 was reported to regulate red blood cell development in zebrafish via the cholesterol synthesis pathway.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human ETV7

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: IIKKEPGQKLLFRFLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEIS