AV33880-100UL Display Image

Anti-CNP

Code: AV33880-100UL D2-231

Biochem/physiol Actions

2′,3′-Cyclic nucleotide-3′-phosphodiesterase (CNP1 and CNP2) is the major enzyme of central nervous system myelin. It is associated ...


read more

Your Price
£377.00 100UL
£452.40 inc. VAT

Biochem/physiol Actions

2′,3′-Cyclic nucleotide-3′-phosphodiesterase (CNP1 and CNP2) is the major enzyme of central nervous system myelin. It is associated with oligodendroglial plasma membrane and uncompacted myelin (myelin-like fraction), which are in contact with glial cytoplasm

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human CNP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLF

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... CNP(1267)
mol wt45 kDa
NCBI accession no.NP_149124
Quality Level100
shipped inwet ice
species reactivityhorse, human, sheep
storage temp.−20°C
technique(s)western blot: suitable, immunoprecipitation (IP): suitable
UniProt accession no.P09543-2
This product has met the following criteria: