Application
Rabbit Anti-RNF12 antibody can be used for western blot applications at a concentration of 2µg/ml. It can also be used for IHC assays at 4-8µg/ml using paraffin-embedded tissues.
Biochem/physiol Actions
RNF12 is a RING-H2 zinc finger protein. It has been shown to be a ubiquitin protein ligase that targets LIM domain binding 1 (LDB1/CLIM), and causes proteasome-dependent degradation of LDB1. This protein and LDB1 are co-repressors of LHX1/LIM-1, a homeodomain transcription factor. Alternatively spliced transcript variants encoding the same protein have been reported.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
RNF12 is known to modulate the inactivation of X chromosome in mouse embryonic stem (ES) cells. RNF12 can target Smad7 for degradation, and regulate the cell fate and morphogenesis in zebrafish embryos.Rabbit Anti-RNF12 antibody recognizes human, canine, mouse, chicken, bovine, and rat RNF12.
Immunogen
Synthetic peptide directed towards the C terminal region of human RNF12
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AQFFLLNEDDDDQPRGLTKEQIDNLAMRSFGENDALKTCSVCITEYTEGN
This product has met the following criteria: