Application
Anti-TCF12 (AB2) antibody produced in rabbit rabbit is suitable for western blotting at a concentration of 1 µg/ml.
Biochem/physiol Actions
TCF12 suppresses the expression of E-cadherin mRNA in metastatic colorectal cancer cells. The overexpression of TCF12 facilitates cell migration and invasion of these cells. TCF12 has a possible role in maintaining neural stem cells and progenitor cells in undifferentiated state during neurogenesis.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
TCF12 belongs to the Tcf family of transcription factors that activate genes induced by the Wnt pathway.
Immunogen
Synthetic peptide directed towards the N terminal region of human TCF12
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGIDE
This product has met the following criteria: