SAB2101252-100UL Display Image

Anti-KIAA1324

Code: SAB2101252-100UL D2-231

Biochem/physiol Actions

KIAA1324 belongs to the UPF0577 family. It may play a role as a marker of hyperestrogenic state and estrogen-related type I endometrial carcinoma.

...

read more

£411.00 100UL
List Price

Biochem/physiol Actions

KIAA1324 belongs to the UPF0577 family. It may play a role as a marker of hyperestrogenic state and estrogen-related type I endometrial carcinoma.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human KIAA1324

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: PCAEGRYSLGTGIRFDEWDELPHGFASLSANMELDDSAAESTGNCTSSKW

application(s)western blot: suitable
clonepolyclonal
antibody formaffinity isolated antibody
mol wt111 kDa
UniProt accession no.Q6UXG2
concentration0.5 mg - 1 mg/mL
Gene Informationhuman ... KIAA1324(57535)
storage temp.−20°C
Quality Level100
shipped inwet ice
antibody product typeprimary antibodies
species reactivitydog, mouse, horse, rabbit, bovine, human, rat, guinea pig
biological sourcerabbit
conjugateunconjugated
formbuffered aqueous solution