Biochem/physiol Actions

ESX1 is a homeobox gene related to the mouse Esx1 homeobox gene. ESX1 is expressed during all stages of placental development and is localized to sparse areas of trophoblast in terminal villi in association with cytotrophoblastic cells. Proteolytic processing of ESX1 plays a role in concerted regulation of the cell cycle and transcription in human cells.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of mouse ESX1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MESHKKCPCCYCTDLKTFVGAVKEETLQDPQPSLSSTLLEGADYQENAES