Biochem/physiol Actions

NUCB2 is an oncoprotein that is overexpressed in breast cancer. This protein binds calcium and is involved in energy homeostasis and eating regulation in the hypothalamus. It is an important prognostic marker in prostate cancer, promotes osteogenesis and has been identified as anorexigenic and anti-hyperglycemic protein.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human NUCB2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE