AV36244-100UL Display Image

Anti-ZFP42

Code: AV36244-100UL D2-231

Biochem/physiol Actions

ZFP42, also known as REX1 and ZNF754, is a zinc finger protein and a marker of pluripotent stem cells. It is expressed in placenta during spermatogene...


read more

Your Price
£478.00 100UL
£573.60 inc. VAT

Biochem/physiol Actions

ZFP42, also known as REX1 and ZNF754, is a zinc finger protein and a marker of pluripotent stem cells. It is expressed in placenta during spermatogenesis and early embryogenesis. ZFP42 regulates the expression of endogenous retroviral elements in mouse embryonic stem cells.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human ZFP42

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MSQQLKKRAKTRHQKGLGGRAPSGAKPRQGKSSQDLQAEIEPVSAVWALC

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ZFP42(132625)
mol wt35 kDa
NCBI accession no.NP_777560
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q96MM3
This product has met the following criteria: