AV35913-100UL Display Image

Anti-VGLL1

Code: AV35913-100UL D2-231

Biochem/physiol Actions

Vestigial (vg) belongs to a class of genes in Drosophila that is required for wing and muscle development. VGLL1 (Vestigial like 1) acts as a...


read more

Your Price
£377.00 100UL
£452.40 inc. VAT

Biochem/physiol Actions

Vestigial (vg) belongs to a class of genes in Drosophila that is required for wing and muscle development. VGLL1 (Vestigial like 1) acts as a coactivator for the mammalian TEA domain family of transcription factors (TEFs).

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human VGLL1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: LFTYFQGDISSVVDEHFSRALSNIKSPQELTPSSQSEGVMLKNDDSMSPN

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... VGLL1(51442)
mol wt29 kDa
NCBI accession no.NP_057351
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q99990
This product has met the following criteria: