Anti-GLA

Code: AV54296-100UL D2-231

Application

Anti-GLA antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.

Biochem/physiol Actions

GLA ...


 Read more

Your Price
£454.00 100UL
£544.80 inc. VAT

Application

Anti-GLA antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.

Biochem/physiol Actions

GLA gene encodes a homodimeric glycoprotein that hydrolyzes the terminal α-galactosyl moieties from glycolipids and glycoproteins. It also plays a role in catalysing hydrolysis of melibiose into galactose and glucose. Mutation in GLA gene results in fabry disease, a rare lysosomal storage disorder associated with failure to catabolize α-D-galactosyl glycolipid moieties.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human GLA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: PQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTF

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... GLA(2717)
mol wt45 kDa
NCBI accession no.NP_000160
Quality Level100
shipped inwet ice
species reactivitydog, mouse, human, guinea pig, rat
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.P06280
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.