AV36568-100UL Display Image

Anti-ANXA1

Code: AV36568-100UL D2-231

Biochem/physiol Actions

ANXA1 encodes a protein that belongs to a family of Ca(2+)-dependent phospholipid binding proteins which have a molecular weight of approximately 35,0...

read more

£324.00 100UL
List Price

Biochem/physiol Actions

ANXA1 encodes a protein that belongs to a family of Ca(2+)-dependent phospholipid binding proteins which have a molecular weight of approximately 35,000 to 40,000 and are preferentially located on the cytosolic face of the plasma membrane. Annexin I protein has an apparent relative molecular mass of 40 kDa, with phospholipase A2 inhibitory activity. Since phospholipase A2 is required for the biosynthesis of the potent mediators of inflammation, prostaglandins and leukotrienes, annexin I may have potential anti-inflammatory activity.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Annexin A1, ANXA1, also known as lipocortin I, is an anti-inflammatory protein originally identified as a phospholipase A2 (PLA2)-inhibitory protein. Its expression is induced by glucocorticoids in immune cells where it has been shown to promote cellular apoptosis. ANXA1 is a 40 kDa protein that binds to the cytosolic side of the cellular membrane in a Ca-dependent manner.

Immunogen

Synthetic peptide directed towards the N terminal region of human ANXA1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVD

application(s)western blot: suitable
application(s)immunohistochemistry: suitable
clonepolyclonal
NCBI accession no.NP_000691
antibody formIgG fraction of antiserum
Gene Informationhuman ... ANXA1(301)
concentration0.5 mg - 1 mg/mL
storage temp.−20°C
Quality Level100
shipped inwet ice
antibody product typeprimary antibodies
biological sourcerabbit
conjugateunconjugated
mol wt38 kDa
species reactivityhuman
formbuffered aqueous solution
UniProt accession no.P04083