SAB2103600-100UL Display Image

Anti-TTC8

Code: SAB2103600-100UL D2-231

Application

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.Immunofluorescence (1 paper)

read more

£411.00 100UL
List Price

Application

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.Immunofluorescence (1 paper)

Biochem/physiol Actions

The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP exchange factor, which localizes to the basal body and contacts the BBSome. Rab8(GTP) enters the primary cilium and promotes extension of the ciliary membrane. Firstly the BBSome associates with the ciliary membrane and binds to Rabin8, the guanosyl exchange factor (GEF) for Rab8 and then the Rab8-GTP localizes to the cilium and promotes docking and fusion of carrier vesicles to the base of the ciliary membrane.This gene encodes a protein that has been directly linked to Bardet-Biedl syndrome. The primary features of this syndrome include retinal dystrophy, obesity, polydactyly, renal abnormalities and learning disabilities. Experimentation in non-human eukaryotes suggests that this gene is expressed in ciliated cells and that it is involved in the formation of cilia. Alternate transcriptional splice variants have been characterized.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human TTC8

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: ENAIAQVPRPGTSLKLPGTNQTGGPSQAVRPITQAGRPITGFLRPSTQSG

application(s)western blot: suitable
clonepolyclonal
UniProt accession no.Q8TAM2-3
antibody formaffinity isolated antibody
species reactivityhuman, rat
concentration0.5 mg - 1 mg/mL
storage temp.−20°C
Quality Level100
shipped inwet ice
antibody product typeprimary antibodies
biological sourcerabbit
NCBI accession no.NM_198310
conjugateunconjugated
Gene Informationhuman ... TTC8(123016)
mol wt54 kDa
formbuffered aqueous solution