AV35609-100UL Display Image

Anti-TRPM3

Code: AV35609-100UL D2-231

Biochem/physiol Actions

Transient receptor potential cation channel, subfamily M, member 3 (TRPM3) belongs to the TRP family of channels. These cation-selective channels that...

read more

£324.00 100UL
List Price

Biochem/physiol Actions

Transient receptor potential cation channel, subfamily M, member 3 (TRPM3) belongs to the TRP family of channels. These cation-selective channels that regulate homeostasis, calcium signaling, calcium entry and storage.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human TRPM3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: ALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQD

application(s)western blot: suitable
clonepolyclonal
mol wt188 kDa
antibody formIgG fraction of antiserum
concentration0.5 mg - 1 mg/mL
storage temp.−20°C
Quality Level100
shipped inwet ice
antibody product typeprimary antibodies
biological sourcerabbit
UniProt accession no.Q9HCF6-2
conjugateunconjugated
Gene Informationhuman ... TRPM3(80036)
NCBI accession no.NP_996829
species reactivityhorse, human, mouse, rat, bovine, rabbit, guinea pig, dog