SAB2102434-100UL Display Image

Anti-TJP1

Code: SAB2102434-100UL D2-231

Biochem/physiol Actions

TJP1 is a protein located on a cytoplasmic membrane surface of intercellular tight junctions. TJP1 may be involved in signal transduction at cell-cell...

read more

£411.00 100UL
List Price

Biochem/physiol Actions

TJP1 is a protein located on a cytoplasmic membrane surface of intercellular tight junctions. TJP1 may be involved in signal transduction at cell-cell junctions.This gene encodes a protein located on a cytoplasmic membrane surface of intercellular tight junctions. The encoded protein may be involved in signal transduction at cell-cell junctions. Two transcript variants encoding distinct isoforms have been identified for this gene.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human TJP1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: QNHVLKQPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESS

species reactivityhuman, rabbit
application(s)western blot: suitable
application(s)immunohistochemistry: suitable
clonepolyclonal
antibody formaffinity isolated antibody
concentration0.5 mg - 1 mg/mL
mol wt187 kDa
storage temp.−20°C
Quality Level100
Gene Informationhuman ... TJP1(7082)
shipped inwet ice
antibody product typeprimary antibodies
biological sourcerabbit
conjugateunconjugated
UniProt accession no.Q07157
formbuffered aqueous solution