AV40640-100UL Display Image

Anti-SYNCRIP

Code: AV40640-100UL D2-231

Biochem/physiol Actions

Heterogenous nuclear ribonucleoprotein (hnRNP) implicated in mRNA processing mechanisms. SYNCRIP may be involved in translationally coupled mRNA turno...

read more

£312.00 100UL
List Price

Biochem/physiol Actions

Heterogenous nuclear ribonucleoprotein (hnRNP) implicated in mRNA processing mechanisms. SYNCRIP may be involved in translationally coupled mRNA turnover. It implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. It interacts in vitro preferentially with poly(A) and poly(U) RNA sequences.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human SYNCRIP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MATEHVNGNGTEEPMDTTSAVIHSENFQTLLDAGLPQKVAEKLDEIYVAG

application(s)western blot: suitable
clonepolyclonal
NCBI accession no.NP_006363
mol wt69 kDa
antibody formIgG fraction of antiserum
concentration0.5 mg - 1 mg/mL
storage temp.−20°C
Quality Level100
species reactivityhuman, guinea pig, horse, bovine, dog, rabbit, mouse, rat
shipped inwet ice
antibody product typeprimary antibodies
biological sourcerabbit
conjugateunconjugated
UniProt accession no.O60506
Gene Informationhuman ... SYNCRIP(10492)
formbuffered aqueous solution