AV41131-100UL Display Image

Anti-RG9MTD3

Code: AV41131-100UL D2-231

Biochem/physiol Actions

RG9MTD3 belongs to the RNA methyltransferase trmD family, TRM10 subfamily. It is a probable RNA methyltransferase.

Disclaimer

read more

£361.00 100UL
List Price

Biochem/physiol Actions

RG9MTD3 belongs to the RNA methyltransferase trmD family, TRM10 subfamily. It is a probable RNA methyltransferase.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human RG9MTD3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: GEILATGSTAWCSKNVQRKQRHWEKIVAAKKSKRKQEKERRKANRAENPG

application(s)western blot: suitable
clonepolyclonal
UniProt accession no.Q6PF06
antibody formaffinity isolated antibody
Gene Informationhuman ... RG9MTD3(158234)
mol wt36 kDa
concentration0.5 mg - 1 mg/mL
storage temp.−20°C
Quality Level100
species reactivityrabbit, horse, bovine, dog, human, pig
shipped inwet ice
antibody product typeprimary antibodies
biological sourcerabbit
conjugateunconjugated
NCBI accession no.NP_659401
formbuffered aqueous solution