AV41839-100UL Display Image

Anti-LSS

Code: AV41839-100UL D2-231

Biochem/physiol Actions

LSS catalyzes the conversion of (S)-2,3 oxidosqualene to lanosterol. It is a member of the terpene cyclase/mutase family and catalyzes the first step ...

read more

£396.00 100UL
List Price

Biochem/physiol Actions

LSS catalyzes the conversion of (S)-2,3 oxidosqualene to lanosterol. It is a member of the terpene cyclase/mutase family and catalyzes the first step in the biosynthesis of cholesterol, steroid hormones, and vitamin D. Two transcript variants encoding the same protein have been found for this gene.The protein encoded by this gene catalyzes the conversion of (S)-2,3 oxidosqualene to lanosterol. The encoded protein is a member of the terpene cyclase/mutase family and catalyzes the first step in the biosynthesis of cholesterol, steroid hormones, and vitamin D. Two transcript variants encoding the same protein have been found for this gene.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human LSS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: TEGTCLRRRGGPYKTEPATDLGRWRLNCERGRQTWTYLQDERAGREQTGL

application(s)western blot: suitable
clonepolyclonal
antibody formaffinity isolated antibody
Gene Informationhuman ... LSS(4047)
mol wt83 kDa
concentration0.5 mg - 1 mg/mL
UniProt accession no.P48449
storage temp.−20°C
Quality Level100
shipped inwet ice
antibody product typeprimary antibodies
biological sourcerabbit
conjugateunconjugated
species reactivityguinea pig, bovine, rabbit, human, rat, mouse
NCBI accession no.NP_002331
formbuffered aqueous solution