AV41695-100UL Display Image

Anti-LCAT

Code: AV41695-100UL D2-231

Biochem/physiol Actions

LCAT is an extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for chole...

read more

£284.00 100UL
List Price

Biochem/physiol Actions

LCAT is an extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in its gene have been found to cause fish-eye disease as well as LCAT deficiency.This gene encodes the extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in this gene have been found to cause fish-eye disease as well as LCAT deficiency.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human LCAT

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MGPPGSPWQWVTLLLGLLLPPAAPFWLLNVLFPPHTTPKAELSNHTRPVI

application(s)western blot: suitable
clonepolyclonal
species reactivitymouse, bovine, horse, human, guinea pig, rabbit, dog, rat, sheep
mol wt48 kDa
antibody formIgG fraction of antiserum
concentration0.5 mg - 1 mg/mL
storage temp.−20°C
Quality Level100
NCBI accession no.NP_000220
UniProt accession no.P04180
shipped inwet ice
antibody product typeprimary antibodies
biological sourcerabbit
conjugateunconjugated
Gene Informationhuman ... LCAT(3931)
formbuffered aqueous solution