SAB2101273-100UL Display Image

Anti-KLF14

Code: SAB2101273-100UL D2-231

Biochem/physiol Actions

KLF14 belongs to the Sp1 C2H2-type zinc-finger protein family. It contains 3 C2H2-type zinc fingers. The exact function of KLF14 is not known.

<...


read more

Your Price
£478.00 100UL
£573.60 inc. VAT

Biochem/physiol Actions

KLF14 belongs to the Sp1 C2H2-type zinc-finger protein family. It contains 3 C2H2-type zinc fingers. The exact function of KLF14 is not known.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human KLF14

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SAAVACLDYFAAECLVSMSAGAVVHRRPPDPEGAGGAAGSEVGAAHPESA

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... KLF14(136259)
mol wt33 kDa
Quality Level100
shipped inwet ice
species reactivityhuman, dog
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q8TD94
This product has met the following criteria: