SAB2107278-100UL Display Image

Anti-DENND1A

Code: SAB2107278-100UL D2-231

Biochem/physiol Actions

DENN domain containing 1A (DENND1A) acts as a guanine nucleotide-exchange factor and plays a vital role in membrane trafficking by interacting with me...


read more

Your Price
£466.00 100UL
£559.20 inc. VAT

Biochem/physiol Actions

DENN domain containing 1A (DENND1A) acts as a guanine nucleotide-exchange factor and plays a vital role in membrane trafficking by interacting with members of the Rab family of small guanosine triphosphatase (GTPases). The encoded protein interacts with lipids, mainly phosphoinositol-3-phosphate and other endocytosis/endosome proteins. DENND1A is also implicated in endosomal recycling and aberrations in the protein function might alter insulin secretion. Elevated expression/Mutation in the gene is associated with the development of polycystic ovary syndrome (PCOS).

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

DENN domain containing 1A (DENND1A) gene with 22 exons, spanning 500,000 bases on genomic DNA, is encoded by the gene mapped to human chromosome 9q22.32. DENND1A belongs to the family of 18 human genes, called “connecdenns”. The encoded protein contains clathrin-binding domain involved in endocytosis and receptor-mediated turnover.1 DENND1A is widely expressed, but at high levels in brain and kidneys.”

Immunogen

The immunogen for anti-DENND1A antibody: synthetic peptide derected towards the C terminal of human DENND1A

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: QPLGQAKSLEDLRAPKDLREQPGSFDYQRLDLCRSERGLSMAAALKLAHP

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... DENND1A(57706)mouse ... Dennd1a(227801)
mol wt111 kDa
NCBI accession no.NM_146122
Quality Level100
shipped inwet ice
species reactivityhuman, mouse, rabbit
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q8TEH3
This product has met the following criteria: