Application

Rabbit Anti-CACNB2 antibody is suitable for western blot applications at a concentration of 1.25 µg/ml.

Biochem/physiol Actions

CACNB2 is a member of the ion-channel gene superfamily. Described as a Lambert-Eaton myasthenic syndrome (LEMS) antigen in humans, this gene is found close to a region that undergoes chromosome rearrangements in small cell lung cancer, which occurs in association with LEMS.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

CACNB2 codes for a voltage-dependent calcium channel protein. This protein is involved in cardiac cell proliferation. It is also needed for heart tube integrity. CACNB2 variations have been linked to blood pressure and hypertension.Rabbit Anti-CACNB2 antibody recognizes bovine, rabbit, human, mouse, and rat CACNB2.

Immunogen

Synthetic peptide directed towards the middle region of human CACNB2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: DYLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGSQGDQRT