Anti-ALDH1L1

Code: AV52331-100UL D2-231

Biochem/physiol Actions

ALDH1L1 catalyzes the conversion of 10-formyltetrahydrofolate, NADP, and water to tetrahydrofolate, NADPH, and carbon dioxide. ALDH1L1 belongs to the ...


 Read more

Your Price
£393.00 100UL
£471.60 inc. VAT

Biochem/physiol Actions

ALDH1L1 catalyzes the conversion of 10-formyltetrahydrofolate, NADP, and water to tetrahydrofolate, NADPH, and carbon dioxide. ALDH1L1 belongs to the aldehyde dehydrogenase family and is responsible for formate oxidation in vivo. Deficiencies in this gene can result in an accumulation of formate and subsequent methanol poisoning.The protein encoded by this gene catalyzes the conversion of 10-formyltetrahydrofolate, NADP, and water to tetrahydrofolate, NADPH, and carbon dioxide. The encoded protein belongs to the aldehyde dehydrogenase family and is responsible for formate oxidation in vivo. Deficiencies in this gene can result in an accumulation of formate and subsequent methanol poisoning.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human ALDH1L1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: LTLKAGIPKGVVNVLPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMKS

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ALDH1L1(10840)
mol wt99 kDa
NCBI accession no.NP_036322
Quality Level100
shipped inwet ice
species reactivityrat, dog, sheep, horse, mouse, guinea pig, bovine, human
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.O75891
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.