SAB2102755-100UL Display Image

Anti-ZDHHC14

Code: SAB2102755-100UL D2-231

Biochem/physiol Actions

ZDHHC14 belongs to the DHHC palmitoyltransferase family, ERF2/ZDHHC9 subfamily. It contains 1 DHHC-type zinc finger. It is a multi-pass membrane prote...

read more

£396.00 100UL
List Price

Biochem/physiol Actions

ZDHHC14 belongs to the DHHC palmitoyltransferase family, ERF2/ZDHHC9 subfamily. It contains 1 DHHC-type zinc finger. It is a multi-pass membrane protein.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human ZDHHC14

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: TLLRTSFSDPGVLPRATPDEAADLERQIDIANGTSSGGYRPPPRTKEVII

UniProt accession no.Q8IZN3
application(s)western blot: suitable
clonepolyclonal
antibody formaffinity isolated antibody
Gene Informationhuman ... ZDHHC14(79683)
concentration0.5 mg - 1 mg/mL
storage temp.−20°C
Quality Level100
shipped inwet ice
antibody product typeprimary antibodies
biological sourcerabbit
conjugateunconjugated
species reactivitymouse, guinea pig, human, horse, dog, rat, bovine, rabbit
formbuffered aqueous solution
mol wt53 kDa