Application

Anti-YY1 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1 µg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 µg/ml is suitable.

Biochem/physiol Actions

Yin Yang 1 (YY1) is a transcription factor with multiple functions in cell proliferation, differentiation, apoptosis and cell cycle progression. YY1 physically interacts with YAF2 protein; this interaction is essential for the recruitment of Polycomb group of proteins to the DNA. It also interacts with GATA3 to regulate Th2 cytokine locus and cell differentiation.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human YY1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: KQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGPR