SAB2105037-100UL Display Image

Anti-TMEM158

Code: SAB2105037-100UL D2-231

Biochem/physiol Actions

TMEM158 is the receptor for brain injury-derived neurotrophic peptide (BINP), a synthetic 13-mer peptide.

Disclaimer

Unle...

read more

£411.00 100UL
List Price

Biochem/physiol Actions

TMEM158 is the receptor for brain injury-derived neurotrophic peptide (BINP), a synthetic 13-mer peptide.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human TMEM158

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: AHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVRGRRTGR

application(s)western blot: suitable
clonepolyclonal
antibody formaffinity isolated antibody
UniProt accession no.Q8WZ71
species reactivitymouse, pig, rat, human, bovine
Gene Informationhuman ... TMEM158(25907)
concentration0.5 mg - 1 mg/mL
mol wt30 kDa
storage temp.−20°C
Quality Level100
shipped inwet ice
antibody product typeprimary antibodies
biological sourcerabbit
NCBI accession no.NM_015444
conjugateunconjugated
formbuffered aqueous solution