AV43905-100UL Display Image

Anti-SLC20A1

Code: AV43905-100UL D2-231

Application

Anti-SLC20A1 polyclonal antibody is used to tag solute carrier family 20 (phosphate transporter) member 1/gibbon ape leukemia virus 1 protein for detection and qu...

read more

£411.00 100UL
List Price

Application

Anti-SLC20A1 polyclonal antibody is used to tag solute carrier family 20 (phosphate transporter) member 1/gibbon ape leukemia virus 1 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 20 (phosphate transporter) member 1/gibbon ape leukemia virus 1 protein in Pi homeostasis.

Biochem/physiol Actions

Retrovirus receptors allow infection of human and murine cells by various retroviruses. The receptors that have been identified at the molecular level include CD4 (MIM 186940) for human immunodeficiency virus, Rec1 for murine ecotropic virus, and GLVR1 (SLC20A1) for gibbon ape leukemia virus. These 3 proteins show no homology to one another at the DNA or protein level. GLVR1 is a sodium-dependent phosphate symporter.Retrovirus receptors allow infection of human and murine cells by various retroviruses. The receptors that have been identified at the molecular level include CD4 (MIM 186940) for human immunodeficiency virus, Rec1 for murine ecotropic virus, and GLVR1 for gibbon ape leukemia virus (see MIM 182090). These 3 proteins show no homology to one another at the DNA or protein level. GLVR1 is a sodium-dependent phosphate symporter.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Solute carrier family 20 (phosphate transporter) member 1/gibbon ape leukemia virus 1 (SLC20A1, GLVR1, PiT-1) is a type III Na+-dependent Pi transporter responsible for the transport of inorganic phosphate (Pi) and maintenance of Pi homeostasis that supports biological processes such as nucleic acid synthesis, tooth mineralization, skeletal development and various signaling cascades.

Immunogen

Synthetic peptide directed towards the C terminal region of human SLC20A1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: LVALYLVYDTGDVSSKVATPIWLLLYGGVGICVGLWVWGRRVIQTMGKDL

Specificity

Anti-SLC20A1 polyclonal antibody reacts with canine and human solute carrier family 20 (phosphate transporter) member 1 proteins.

application(s)western blot: suitable
clonepolyclonal
antibody formaffinity isolated antibody
Gene Informationhuman ... SLC20A1(6574)
concentration0.5 mg - 1 mg/mL
storage temp.−20°C
Quality Level100
shipped inwet ice
antibody product typeprimary antibodies
biological sourcerabbit
species reactivitypig, human, dog, horse, bovine
conjugateunconjugated
NCBI accession no.NP_005406
mol wt74 kDa
UniProt accession no.Q8WUM9
formbuffered aqueous solution