Application
Anti-SLC16A8 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5µg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8µg/ml.
Biochem/physiol Actions
SLC16A8 (MCT3) is a proton-coupled monocarboxylate transporter that facilitates the movement of lactate across the cell membranes. Mutation in the gene for MCT3 results in altered visual function in mice and has been associated with age-related macular degeneration.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the middle region of human SLC16A8
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RAFAVYAVTKFLMALGLFVPAILLVNYAKDAGVPDTDAAFLLSIVGFVDI
This product has met the following criteria: