SAB2105637-100UL Display Image

Anti-SCG2

Code: SAB2105637-100UL D2-231

Biochem/physiol Actions

The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. Studies in rodents suggest...

read more

£411.00 100UL
List Price

Biochem/physiol Actions

The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. Studies in rodents suggest that the full-length protein, secretogranin II, is involved in the packaging or sorting of peptide hormones and neuropeptides into secretory vesicles. The full-length protein is cleaved to produce the active peptide secretoneurin, which exerts chemotaxic effects on specific cell types, and EM66, whose function is unknown.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human SCG2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: KEESSPDYNPYQGVSVPLQQKENGDESHLPERDSLSEEDWMRIILEALRQ

application(s)western blot: suitable
clonepolyclonal
UniProt accession no.P13521
antibody formaffinity isolated antibody
Gene Informationhuman ... SCG2(7857)
species reactivityhuman, horse, pig, bovine, rabbit, mouse
concentration0.5 mg - 1 mg/mL
storage temp.−20°C
Quality Level100
shipped inwet ice
antibody product typeprimary antibodies
mol wt71 kDa
biological sourcerabbit
conjugateunconjugated
formbuffered aqueous solution
NCBI accession no.NM_003469