SAB2103543-100UL Display Image

Anti-RNF169

Code: SAB2103543-100UL D2-231

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to b...

read more

£396.00 100UL
List Price

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human RNF169

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: DTETGKRKMDEQKKRDEPLVLKTNLERCPARLSDSENEEPSRGQMTQTHR

NCBI accession no.NM_001098638
application(s)western blot: suitable
clonepolyclonal
antibody formaffinity isolated antibody
species reactivityrat, human, dog, bovine, horse, guinea pig, mouse
mol wt77 kDa
UniProt accession no.Q8NCN4
concentration0.5 mg - 1 mg/mL
storage temp.−20°C
Quality Level100
shipped inwet ice
antibody product typeprimary antibodies
biological sourcerabbit
Gene Informationhuman ... RNF169(254225)
conjugateunconjugated
formbuffered aqueous solution