SAB2108612-100UL Display Image

ANTI-NDUFV1

Code: SAB2108612-100UL D2-231

Biochem/physiol Actions

NDUFV1 is the 51-kD subunit of complex I (NADH:ubiquinone oxidoreductase) of the mitochondrial respiratory chain.The NDUFV1 gene encodes the 51-kD sub...

read more

£324.00 100UL
List Price

Biochem/physiol Actions

NDUFV1 is the 51-kD subunit of complex I (NADH:ubiquinone oxidoreductase) of the mitochondrial respiratory chain.The NDUFV1 gene encodes the 51-kD subunit of complex I (NADH:ubiquinone oxidoreductase) of the mitochondrial respiratory chain.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human NDUFV1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: FMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMG

species reactivityguinea pig, horse, dog, rat, human, bovine, mouse
clonepolyclonal
application(s)immunoblotting: suitable
concentration0.5-1 mg/mL
mol wt51 kDa
Gene Informationhuman ... NDUFV1(4723)
antibody formIgG fraction of antiserum
storage temp.−20°C
Quality Level100
accession no.NM_007103
shipped inwet ice
antibody product typeprimary antibodies
biological sourcerabbit
conjugateunconjugated
UniProt accession no.P49821
formbuffered aqueous solution