SAB2108672-100UL Display Image

ANTI-HACE1

Code: SAB2108672-100UL D2-231

Biochem/physiol Actions

HACE1 contains 6 ANK repeats and 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain. HACE1 is an E3 ubiquitin-protein ligase that may function in c...

read more

£396.00 100UL
List Price

Biochem/physiol Actions

HACE1 contains 6 ANK repeats and 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain. HACE1 is an E3 ubiquitin-protein ligase that may function in cellular proteins degradation.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human HACE1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: DVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRV

clonepolyclonal
species reactivityrabbit, mouse, human, guinea pig, horse, rat, bovine, dog
antibody formaffinity isolated antibody
application(s)immunoblotting: suitable
concentration0.5-1 mg/mL
mol wt102 kDa
accession no.NM_020771
storage temp.−20°C
Quality Level100
shipped inwet ice
antibody product typeprimary antibodies
biological sourcerabbit
Gene Informationhuman ... HACE1(57531)
conjugateunconjugated
UniProt accession no.Q8IYU2
formbuffered aqueous solution