SAB2100284-100UL Display Image


Code: SAB2100284-100UL D2-231


Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to b...

read more

£411.00 100UL
List Price


Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Synthetic peptide directed towards the N terminal region of human C21orf2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.


Synthetic peptide located within the following region: KLTRKMVLTRAKASELHSVRKLNCWGSRLTDISICQEMPSLEVITLSVNS

application(s)western blot: suitable
antibody formaffinity isolated antibody
Gene Informationhuman ... C21orf2(755)
concentration0.5 mg - 1 mg/mL
storage temp.−20°C
Quality Level100
shipped inwet ice
antibody product typeprimary antibodies
biological sourcerabbit
UniProt accession no.O43822
species reactivityguinea pig, horse, rat, bovine, dog, human
formbuffered aqueous solution
mol wt28 kDa