Application
Rabbit Anti-C19ORF47 antibody is suitable for western blot applications at a concentration of 0.25 µg/ml.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
C19ORF47 is a protein coding gene that is expressed in the nucleus. Rabbit Anti-C19ORF47 antibody recognizes human and mouse C19ORF47.
Immunogen
Synthetic peptide directed towards the C terminal region of human C19orf47
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DSQVTSTKSKSSAEVKVTIKRTLVGPRGSSSSEGLGAQMDHAGTVSVFKR
This product has met the following criteria: