AV48453-100UL Display Image

Anti-C19ORF47

Code: AV48453-100UL D2-231

Application

Rabbit Anti-C19ORF47 antibody is suitable for western blot applications at a concentration of 0.25 µg/ml.

Disclaimer

Unless othe...

read more

£396.00 100UL
List Price

Application

Rabbit Anti-C19ORF47 antibody is suitable for western blot applications at a concentration of 0.25 µg/ml.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

C19ORF47 is a protein coding gene that is expressed in the nucleus. Rabbit Anti-C19ORF47 antibody recognizes human and mouse C19ORF47.

Immunogen

Synthetic peptide directed towards the C terminal region of human C19orf47

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: DSQVTSTKSKSSAEVKVTIKRTLVGPRGSSSSEGLGAQMDHAGTVSVFKR

application(s)western blot: suitable
clonepolyclonal
Gene Informationhuman ... C19orf47(126526)
antibody formaffinity isolated antibody
concentration0.5 mg - 1 mg/mL
storage temp.−20°C
Quality Level100
UniProt accession no.Q8N9M1-2
shipped inwet ice
antibody product typeprimary antibodies
biological sourcerabbit
conjugateunconjugated
species reactivitymouse, guinea pig, rat, human
mol wt38 kDa
NCBI accession no.NP_849152
formbuffered aqueous solution