SAB2103179-100UL Display Image

Anti-BCL6B

Code: SAB2103179-100UL D2-231

Biochem/physiol Actions

BCL6B acts as a sequence-specific transcriptional repressor in association with BCL6. BCL6B may function in a narrow stage or be related to some event...

read more

£411.00 100UL
List Price

Biochem/physiol Actions

BCL6B acts as a sequence-specific transcriptional repressor in association with BCL6. BCL6B may function in a narrow stage or be related to some events in the early B-cell development.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human BCL6B

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: LQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVE

mol wt52 kDa
application(s)western blot: suitable
clonepolyclonal
antibody formaffinity isolated antibody
species reactivitybovine, human, rabbit, guinea pig, rat, horse
concentration0.5 mg - 1 mg/mL
Gene Informationhuman ... BCL6B(255877)
storage temp.−20°C
Quality Level100
UniProt accession no.Q8N143
shipped inwet ice
antibody product typeprimary antibodies
biological sourcerabbit
NCBI accession no.NM_181844
conjugateunconjugated
formbuffered aqueous solution